PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_15681.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 199aa    MW: 22514.1 Da    PI: 6.301
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_15681.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM107.81.3e-3371241128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGf+F P+deelv ++L++k++  +++  ++++++  ++++Pw+L+ k+ +  ++wyfFs++ +     +r++r   +gyW+  g d++v+s +g
  MLOC_15681.2   7 LPPGFHFFPSDEELVIHFLRRKAALLPCRP-DIVPTLPQNRYDPWELNGKALQAGNQWYFFSQATQ-----SRTSR---NGYWNPIGADEAVTS-GG 93 
                   79*************************999.89**************966667789******9754.....35555...8**************.99 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   ++vglkktLvf  g+  +++kt+Wvmhey+l
  MLOC_15681.2  94 SHVGLKKTLVFSIGEPFQATKTNWVMHEYHL 124
                   9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-444162IPR003441NAC domain
PROSITE profilePS5100540.957163IPR003441NAC domain
PfamPF023658.0E-238124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MGGSTNLPPG FHFFPSDEEL VIHFLRRKAA LLPCRPDIVP TLPQNRYDPW ELNGKALQAG  60
NQWYFFSQAT QSRTSRNGYW NPIGADEAVT SGGSHVGLKK TLVFSIGEPF QATKTNWVMH  120
EYHLLDENGG TSTSGSSRKR SHKKKGHPDK ECSNWVVCRV FESNYDSQVS FHQEDMELSC  180
LDEVFLSLDD YDEVSLPKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-34616816170NO APICAL MERISTEM PROTEIN
1ut4_B2e-34616816170NO APICAL MERISTEM PROTEIN
1ut7_A2e-34616816170NO APICAL MERISTEM PROTEIN
1ut7_B2e-34616816170NO APICAL MERISTEM PROTEIN
3swm_A1e-34616819173NAC domain-containing protein 19
3swm_B1e-34616819173NAC domain-containing protein 19
3swm_C1e-34616819173NAC domain-containing protein 19
3swm_D1e-34616819173NAC domain-containing protein 19
3swp_A1e-34616819173NAC domain-containing protein 19
3swp_B1e-34616819173NAC domain-containing protein 19
3swp_C1e-34616819173NAC domain-containing protein 19
3swp_D1e-34616819173NAC domain-containing protein 19
4dul_A2e-34616816170NAC domain-containing protein 19
4dul_B2e-34616816170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197670.0FR819767.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC026 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579793.11e-117PREDICTED: NAC transcription factor NAM-1
SwissprotQ8GWK63e-64NC104_ARATH; NAC domain-containing protein 104
TrEMBLF6IAY61e-150F6IAY6_HORVD; NAC transcription factor
STRINGMLOC_15681.21e-150(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.13e-64xylem NAC domain 1